PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 335aa    MW: 37610.9 Da    PI: 6.0396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584763.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
   XP_013584763.1 32 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 79
                     678*****************************99************97 PP

2Myb_DNA-binding48.22.6e-1585129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+ +++  lG++ W+ Ia +++ gRt++++k++w++ 
   XP_013584763.1  85 RGSFSPQEEDLIFHLHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 129
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-222682IPR009057Homeodomain-like
PROSITE profilePS5129417.3092779IPR017930Myb domain
SuperFamilySSF466891.13E-2729126IPR009057Homeodomain-like
SMARTSM007171.7E-123181IPR001005SANT/Myb domain
PfamPF002496.4E-143279IPR001005SANT/Myb domain
CDDcd001673.52E-103579No hitNo description
PROSITE profilePS5129425.46780134IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2583135IPR009057Homeodomain-like
SMARTSM007171.4E-1584132IPR001005SANT/Myb domain
PfamPF002494.2E-1485129IPR001005SANT/Myb domain
CDDcd001678.54E-1187130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MMMRNQDITT IRDKNKASNA CGGNNNKPKL RKGLWSPDED EKLIRYMLTN GQGCWSDIAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGSFSP QEEDLIFHLH SILGNRWSQI ATRLPGRTDN  120
EIKNFWNSTL KKKLKNNNTS SGSSPNNSNS NSLEPIDQHV DMGGNSNPMM NSHHHQDDMM  180
IVGNTMHMES SSFYAPVVTS VGLNQLDPLI SVTDHNRYQQ MANTGNNNVN GLGDYGSAVL  240
DPISNRASVE SEWFLPPSEN TNIMACTTSN NLNLEALDPC FGSKNMCHSE SFKVGNIMGM  300
ENSSWEIENP KIGDWDLDSL IDNNSSFPFL DFQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-29141346128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893680.0AC189368.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB047A09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584763.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0D3CLU80.0A0A0D3CLU8_BRAOL; Uncharacterized protein
STRINGBra029696.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.10.0myb domain protein 83